Lineage for d2azoa_ (2azo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121326Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 protein domains)
  6. 2121327Protein DNA mismatch repair protein MutH from [53021] (1 species)
  7. 2121328Species Escherichia coli [TaxId:562] [53022] (2 PDB entries)
  8. 2121330Domain d2azoa_: 2azo A: [33330]

Details for d2azoa_

PDB Entry: 2azo (more details), 2.3 Å

PDB Description: dna mismatch repair protein muth from e. coli
PDB Compounds: (A:) muth

SCOPe Domain Sequences for d2azoa_:

Sequence, based on SEQRES records: (download)

>d2azoa_ c.52.1.14 (A:) DNA mismatch repair protein MutH from {Escherichia coli [TaxId: 562]}
qprpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvlleiwlgas
agskpeqdfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhklkrvlw
ipvegersiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarhgeylq
irpkaanakalteaigargeriltlprgfylkknftsallarhfliq

Sequence, based on observed residues (ATOM records): (download)

>d2azoa_ c.52.1.14 (A:) DNA mismatch repair protein MutH from {Escherichia coli [TaxId: 562]}
qprpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvlleiwlgas
agfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhklkrvlwipvege
rsiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarhgeylqirpkak
alteaigargeriltlprgfylkknftsallarhfliq

SCOPe Domain Coordinates for d2azoa_:

Click to download the PDB-style file with coordinates for d2azoa_.
(The format of our PDB-style files is described here.)

Timeline for d2azoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2azob_