Lineage for d5v6dm_ (5v6d M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951502Species Neisseria gonorrhoeae [TaxId:521006] [333277] (1 PDB entry)
  8. 2951515Domain d5v6dm_: 5v6d M: [333291]
    automated match to d4hr2b_
    complexed with cit, edo

Details for d5v6dm_

PDB Entry: 5v6d (more details), 1.85 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate
PDB Compounds: (M:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5v6dm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v6dm_ d.58.6.1 (M:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
maiertisiikpdavgknvigkiysrfeenglkivaakmkqltlkeaqefyavhkdrpfy
aglvefmtggpvmiqvlegenavlknrelmgatnpteaaegtiradfatsvsinavhgsd
svenaaleiayffsqteicpr

SCOPe Domain Coordinates for d5v6dm_:

Click to download the PDB-style file with coordinates for d5v6dm_.
(The format of our PDB-style files is described here.)

Timeline for d5v6dm_: