| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
| Protein automated matches [195455] (14 species) not a true protein |
| Species Salmonella typhimurium [TaxId:588858] [333279] (1 PDB entry) |
| Domain d5vesa_: 5ves A: [333280] automated match to d2mqea_ complexed with so4 |
PDB Entry: 5ves (more details), 2.4 Å
SCOPe Domain Sequences for d5vesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vesa_ d.79.7.0 (A:) automated matches {Salmonella typhimurium [TaxId: 588858]}
qtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsdayn
qglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdrrv
eievkgv
Timeline for d5vesa_: