SCOPe 2.08: Domain d5vesa_: 5ves A:

Lineage for d5vesa_ (5ves A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:588858] [333279] (1 PDB entry)

8. Domain d5vesa_: 5ves A: [333280]
   automated match to d2mqea_
   complexed with so4

Details for d5vesa_

PDB Entry: 5ves, 2.4 Å

PDB Description: the 2.4a crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s

PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d5vesa_:

Sequence; same for both SEQRES and ATOM records:

>d5vesa_ d.79.7.0 (A:) automated matches {Salmonella typhimurium [TaxId: 588858]}
qtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsdayn
qglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdrrv
eievkgv

Timeline for d5vesa_:

• d5vesa_ first appeared in SCOPe 2.06
  
• d5vesa_ appears in SCOPe 2.07