| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries) |
| Domain d5mgda4: 5mgd A:664-845 [333262] Other proteins in same PDB: d5mgda1, d5mgda2, d5mgda3, d5mgda6 automated match to d1tg7a2 complexed with 1pe, cl, dms, nag |
PDB Entry: 5mgd (more details), 2.15 Å
SCOPe Domain Sequences for d5mgda4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgda4 b.18.1.0 (A:664-845) automated matches {Aspergillus niger [TaxId: 425011]}
apdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssdygf
htgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynatynlp
qlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnlgge
dy
Timeline for d5mgda4: