Lineage for d5mgda1 (5mgd A:41-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441078Species Aspergillus niger [TaxId:425011] [333178] (6 PDB entries)
  8. 2441080Domain d5mgda1: 5mgd A:41-393 [333259]
    Other proteins in same PDB: d5mgda2, d5mgda3, d5mgda4, d5mgda5, d5mgda6
    automated match to d1tg7a5
    complexed with 1pe, bma, cl, dms, gal, glc, man, nag

Details for d5mgda1

PDB Entry: 5mgd (more details), 2.15 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 6-galactosyl-lactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5mgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mgda1 c.1.8.0 (A:41-393) automated matches {Aspergillus niger [TaxId: 425011]}
llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvsp

SCOPe Domain Coordinates for d5mgda1:

Click to download the PDB-style file with coordinates for d5mgda1.
(The format of our PDB-style files is described here.)

Timeline for d5mgda1: