Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Aspergillus niger [TaxId:425011] [333178] (6 PDB entries) |
Domain d5mgda1: 5mgd A:41-393 [333259] Other proteins in same PDB: d5mgda2, d5mgda3, d5mgda4, d5mgda5, d5mgda6 automated match to d1tg7a5 complexed with 1pe, bma, cl, dms, gal, glc, man, nag |
PDB Entry: 5mgd (more details), 2.15 Å
SCOPe Domain Sequences for d5mgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgda1 c.1.8.0 (A:41-393) automated matches {Aspergillus niger [TaxId: 425011]} llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvsp
Timeline for d5mgda1: