Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries) |
Domain d5nhva_: 5nhv A: [333255] automated match to d1erka_ complexed with 8qb, so4 |
PDB Entry: 5nhv (more details), 2 Å
SCOPe Domain Sequences for d5nhva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nhva_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfq
Timeline for d5nhva_: