Lineage for d5szdd_ (5szd D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057725Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2057726Protein automated matches [190914] (13 species)
    not a true protein
  7. 2057730Species Aquifex aeolicus [TaxId:224324] [333224] (1 PDB entry)
  8. 2057734Domain d5szdd_: 5szd D: [333246]
    Other proteins in same PDB: d5szda2, d5szdb2, d5szdc2, d5szdf2, d5szdg2, d5szdh2, d5szdi2, d5szdj2, d5szdk2, d5szdl2
    automated match to d3sb2a_
    complexed with cl, gai, mpd, mrd, peg

Details for d5szdd_

PDB Entry: 5szd (more details), 1.49 Å

PDB Description: crystal structure of aquifex aeolicus hfq at 1.5a
PDB Compounds: (D:) RNA-binding protein Hfq

SCOPe Domain Sequences for d5szdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szdd_ b.38.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt
ivpherlei

SCOPe Domain Coordinates for d5szdd_:

Click to download the PDB-style file with coordinates for d5szdd_.
(The format of our PDB-style files is described here.)

Timeline for d5szdd_: