![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein CREB-binding protein, CBP [74712] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries) |
![]() | Domain d5mqgb_: 5mqg B: [333220] automated match to d4nyva_ complexed with f31 |
PDB Entry: 5mqg (more details), 1.35 Å
SCOPe Domain Sequences for d5mqgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mqgb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
Timeline for d5mqgb_: