Lineage for d1dc1b_ (1dc1 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121303Family c.52.1.11: Restriction endonuclease BsobI [53011] (1 protein)
    automatically mapped to Pfam PF09194
  6. 2121304Protein Restriction endonuclease BsobI [53012] (1 species)
  7. 2121305Species Bacillus stearothermophilus [TaxId:1422] [53013] (1 PDB entry)
  8. 2121307Domain d1dc1b_: 1dc1 B: [33322]
    protein/DNA complex; complexed with dio

Details for d1dc1b_

PDB Entry: 1dc1 (more details), 1.7 Å

PDB Description: restriction enzyme bsobi/dna complex structure: encirclement of the dna and histidine-catalyzed hydrolysis within a canonical restriction enzyme fold
PDB Compounds: (B:) bsobi restriction endonuclease

SCOPe Domain Sequences for d1dc1b_:

Sequence, based on SEQRES records: (download)

>d1dc1b_ c.52.1.11 (B:) Restriction endonuclease BsobI {Bacillus stearothermophilus [TaxId: 1422]}
qkpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpkdll
ylediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryllfqg
dslggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyeletf
akgiswtingkhrtlmynitvslvkknvdiclfncepeiytpqkvhqqpekylllgelkg
gidpagadehwktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgsltn
sanltkteqvgslcrwiini

Sequence, based on observed residues (ATOM records): (download)

>d1dc1b_ c.52.1.11 (B:) Restriction endonuclease BsobI {Bacillus stearothermophilus [TaxId: 1422]}
qkpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpkdll
ylediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryllfqg
dslggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyeletf
akgiswtingkhrtlmynitvslvkknvdiclfncepqqpekylllgelkggidpagade
hwktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgsltnsanltkteq
vgslcrwiini

SCOPe Domain Coordinates for d1dc1b_:

Click to download the PDB-style file with coordinates for d1dc1b_.
(The format of our PDB-style files is described here.)

Timeline for d1dc1b_: