SCOPe 2.06: Domain d5mgca4: 5mgc A:664-845

Lineage for d5mgca4 (5mgc A:664-845)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries)

8. Domain d5mgca4: 5mgc A:664-845 [333213]
   Other proteins in same PDB: d5mgca1, d5mgca2, d5mgca3, d5mgca6
   automated match to d1tg7a2
   complexed with bma, gal, glc, man, nag

Details for d5mgca4

PDB Entry: 5mgc, 2.3 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 4-galactosyl-lactose

PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5mgca4:

Sequence; same for both SEQRES and ATOM records:

>d5mgca4 b.18.1.0 (A:664-845) automated matches {Aspergillus niger [TaxId: 425011]}
apdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssdygf
htgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynatynlp
qlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnlgge
dy

Timeline for d5mgca4:

• d5mgca4 is new in SCOPe 2.06-stable
  
• d5mgca4 appears in SCOPe 2.07
  
• d5mgca4 appears in the current release, SCOPe 2.08