Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries) |
Domain d5mgca2: 5mgc A:394-566 [333211] Other proteins in same PDB: d5mgca1, d5mgca3, d5mgca4, d5mgca5, d5mgca6 automated match to d1tg7a4 complexed with bma, gal, glc, man, nag |
PDB Entry: 5mgc (more details), 2.3 Å
SCOPe Domain Sequences for d5mgca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgca2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]} gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld
Timeline for d5mgca2: