Lineage for d5juva2 (5juv A:394-566)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2810973Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries)
  8. 2810976Domain d5juva2: 5juv A:394-566 [333204]
    Other proteins in same PDB: d5juva1, d5juva3, d5juva4, d5juva5, d5juva6
    automated match to d1tg7a4
    complexed with 1pe, cl, nag

Details for d5juva2

PDB Entry: 5juv (more details), 2.27 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 6-b-galactopyranosyl galactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5juva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5juva2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]}
gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags
vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh
elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld

SCOPe Domain Coordinates for d5juva2:

Click to download the PDB-style file with coordinates for d5juva2.
(The format of our PDB-style files is described here.)

Timeline for d5juva2: