![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries) |
![]() | Domain d5juva2: 5juv A:394-566 [333204] Other proteins in same PDB: d5juva1, d5juva3, d5juva4, d5juva5, d5juva6 automated match to d1tg7a4 complexed with 1pe, cl, nag |
PDB Entry: 5juv (more details), 2.27 Å
SCOPe Domain Sequences for d5juva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5juva2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]} gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld
Timeline for d5juva2: