SCOPe 2.06: Domain d5ifpa3: 5ifp A:567-663

Lineage for d5ifpa3 (5ifp A:567-663)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
   sandwich; 8 strands in 2 sheets

4. Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families)
   automatically mapped to Pfam PF13363

5. Family b.149.1.0: automated matches [254310] (1 protein)
   not a true family

6. Protein automated matches [254712] (3 species)
   not a true protein

7. Species Aspergillus niger [TaxId:425011] [333183] (6 PDB entries)

8. Domain d5ifpa3: 5ifp A:567-663 [333192]
   Other proteins in same PDB: d5ifpa1, d5ifpa2, d5ifpa4, d5ifpa5, d5ifpa6
   automated match to d1tg7a1
   complexed with bma, btb, cl, gol, man, nag, so4

Details for d5ifpa3

PDB Entry: 5ifp, 1.71 Å

PDB Description: structure of beta-galactosidase from aspergillus niger

PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d5ifpa3:

Sequence; same for both SEQRES and ATOM records:

>d5ifpa3 b.149.1.0 (A:567-663) automated matches {Aspergillus niger [TaxId: 425011]}
rnsaynywvpqlatdgtspgfstpekvassiivkagylvrtaylkgsglyltadfnatts
vevigvpstaknlfingdktshtvdkngiwsatvdyn

Timeline for d5ifpa3:

• d5ifpa3 is new in SCOPe 2.06-stable
  
• d5ifpa3 appears in SCOPe 2.07
  
• d5ifpa3 appears in the current release, SCOPe 2.08