Lineage for d5ifpa1 (5ifp A:41-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441078Species Aspergillus niger [TaxId:425011] [333178] (6 PDB entries)
  8. 2441079Domain d5ifpa1: 5ifp A:41-393 [333188]
    Other proteins in same PDB: d5ifpa2, d5ifpa3, d5ifpa4, d5ifpa5, d5ifpa6
    automated match to d1tg7a5
    complexed with bma, btb, cl, gol, man, nag, so4

Details for d5ifpa1

PDB Entry: 5ifp (more details), 1.71 Å

PDB Description: structure of beta-galactosidase from aspergillus niger
PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d5ifpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifpa1 c.1.8.0 (A:41-393) automated matches {Aspergillus niger [TaxId: 425011]}
llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
frtlhleqspttpyaivefqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvsp

SCOPe Domain Coordinates for d5ifpa1:

Click to download the PDB-style file with coordinates for d5ifpa1.
(The format of our PDB-style files is described here.)

Timeline for d5ifpa1: