Lineage for d5ihra2 (5ihr A:394-566)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420424Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries)
  8. 2420429Domain d5ihra2: 5ihr A:394-566 [333182]
    Other proteins in same PDB: d5ihra1, d5ihra3, d5ihra4, d5ihra5, d5ihra6
    automated match to d1tg7a4
    complexed with bma, cl, dms, gal, glc, man, nag, so4

Details for d5ihra2

PDB Entry: 5ihr (more details), 2.4 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with allolactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ihra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihra2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]}
gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags
vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh
elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld

SCOPe Domain Coordinates for d5ihra2:

Click to download the PDB-style file with coordinates for d5ihra2.
(The format of our PDB-style files is described here.)

Timeline for d5ihra2: