Lineage for d1fiub_ (1fiu B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136390Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein)
    automatically mapped to Pfam PF09015
  6. 2136391Protein Restriction endonuclease NgoIV [53009] (1 species)
  7. 2136392Species Neisseria gonorrhoeae [TaxId:485] [53010] (1 PDB entry)
  8. 2136394Domain d1fiub_: 1fiu B: [33318]
    protein/DNA complex; complexed with acy, mg

Details for d1fiub_

PDB Entry: 1fiu (more details), 1.6 Å

PDB Description: tetrameric restriction endonuclease ngomiv in complex with cleaved dna
PDB Compounds: (B:) type II restriction enzyme ngomi

SCOPe Domain Sequences for d1fiub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiub_ c.52.1.10 (B:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae [TaxId: 485]}
mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl
pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka
aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll
hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc
vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav

SCOPe Domain Coordinates for d1fiub_:

Click to download the PDB-style file with coordinates for d1fiub_.
(The format of our PDB-style files is described here.)

Timeline for d1fiub_: