Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) |
Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein) automatically mapped to Pfam PF09015 |
Protein Restriction endonuclease NgoIV [53009] (1 species) |
Species Neisseria gonorrhoeae [TaxId:485] [53010] (1 PDB entry) |
Domain d1fiub_: 1fiu B: [33318] protein/DNA complex; complexed with acy, mg |
PDB Entry: 1fiu (more details), 1.6 Å
SCOPe Domain Sequences for d1fiub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiub_ c.52.1.10 (B:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae [TaxId: 485]} mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav
Timeline for d1fiub_: