Lineage for d5wq3a_ (5wq3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922991Family c.129.1.0: automated matches [233357] (1 protein)
    not a true family
  6. 2922992Protein automated matches [233358] (8 species)
    not a true protein
  7. 2922993Species Corynebacterium glutamicum [TaxId:1718] [333060] (1 PDB entry)
  8. 2922994Domain d5wq3a_: 5wq3 A: [333141]
    automated match to d1wekd_
    complexed with 1pe, cl, edo, gol, pge, po4

Details for d5wq3a_

PDB Entry: 5wq3 (more details), 1.95 Å

PDB Description: crystal structure of type-ii log from corynebacterium glutamicum
PDB Compounds: (A:) Cytokinin riboside 5'-monophosphate phosphoribohydrolase

SCOPe Domain Sequences for d5wq3a_:

Sequence, based on SEQRES records: (download)

>d5wq3a_ c.129.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
wkhadpwrvlriqsefvagfdalhempkavtvfgsarikedhpyykagvelgeklvaady
avvtgggpglmeapnkgaseanglsvglgielpheqhlnpyvdlglnfryffarktmflk
ysqafvclpggfgtldelfevlcmvqtgkvtnfpivligtefwaglvdwirhrlveegmi
dekdvdrmlvtddldqavkfivdahagl

Sequence, based on observed residues (ATOM records): (download)

>d5wq3a_ c.129.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
wkhadpwrvlriqsefvagfdalhempkavtvfgsarikedhpyykagvelgeklvaady
avvtgggpglmeapnkgaseanglsvglgielphhlnpyvdlglnfryffarktmflkys
qafvclpggfgtldelfevlcmvqtgkvtnfpivligtefwaglvdwirhrlveegmide
kdvdrmlvtddldqavkfivdahagl

SCOPe Domain Coordinates for d5wq3a_:

Click to download the PDB-style file with coordinates for d5wq3a_.
(The format of our PDB-style files is described here.)

Timeline for d5wq3a_: