Lineage for d1d02b_ (1d02 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71634Family c.52.1.8: Restriction endonuclease MunI [53002] (1 protein)
  6. 71635Protein Restriction endonuclease MunI [53003] (1 species)
  7. 71636Species Eubacteria (Mycoplasma unidentified) [53004] (1 PDB entry)
  8. 71638Domain d1d02b_: 1d02 B: [33314]

Details for d1d02b_

PDB Entry: 1d02 (more details), 1.7 Å

PDB Description: crystal structure of muni restriction endonuclease in complex with cognate dna

SCOP Domain Sequences for d1d02b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d02b_ c.52.1.8 (B:) Restriction endonuclease MunI {Eubacteria (Mycoplasma unidentified)}
kselsgrlnwqalaglkasgaeqnlynvfnavfegtkyvlyekpkhlknlyaqvvlpddv
ikeifnplidlsttqwgvspafaientethkilfgeikrqdgwvegkdpsagrgnahers
cklftpgllkayrtiggindeeilpfwvvfegditrdpkrvreitfwydhyqdnyfmwrp
nesgeklvqhfneklkkyld

SCOP Domain Coordinates for d1d02b_:

Click to download the PDB-style file with coordinates for d1d02b_.
(The format of our PDB-style files is described here.)

Timeline for d1d02b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d02a_