Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries) |
Domain d5lg6b1: 5lg6 B:61-282 [333137] Other proteins in same PDB: d5lg6a2, d5lg6a3, d5lg6a4, d5lg6b2, d5lg6b3, d5lg6b4 automated match to d4fkha1 complexed with nag, zn |
PDB Entry: 5lg6 (more details), 2.5 Å
SCOPe Domain Sequences for d5lg6b1:
Sequence, based on SEQRES records: (download)
>d5lg6b1 b.98.1.0 (B:61-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]} ldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs kklnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqge laddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnlta lsnmppkgsstplaedpnwsvtefettpvmstyllayivsef
>d5lg6b1 b.98.1.0 (B:61-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]} ldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs kklnytmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladd lagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnm ppkgsstplaedpnwsvtefettpvmstyllayivsef
Timeline for d5lg6b1:
View in 3D Domains from other chains: (mouse over for more information) d5lg6a1, d5lg6a2, d5lg6a3, d5lg6a4 |