SCOPe 2.06: Domain d5usqa_: 5usq A:

Lineage for d5usqa_ (5usq A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Type I TGF-beta receptor R4 [56144] (1 species)
   TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases

7. Species Human (Homo sapiens) [TaxId:9606] [56145] (25 PDB entries)
   Uniprot P36897 200-500 ! Uniprot P36897 201-503

8. Domain d5usqa_: 5usq A: [333134]
   automated match to d1py5a_
   complexed with 8ly

Details for d5usqa_

PDB Entry: 5usq, 2.55 Å

PDB Description: alk-5 kinase inhibitor complex

PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d5usqa_:

Sequence; same for both SEQRES and ATOM records:

>d5usqa_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq

Timeline for d5usqa_:

• d5usqa_ is new in SCOPe 2.06-stable
  
• d5usqa_ appears in SCOPe 2.07
  
• d5usqa_ appears in the current release, SCOPe 2.08