Lineage for d1cfra_ (1cfr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121264Family c.52.1.7: Cfr10I/Bse634I [52999] (2 protein domains)
    automatically mapped to Pfam PF07832
  6. 2121281Protein Restriction endonuclease Cfr10I [53000] (1 species)
  7. 2121282Species Citrobacter freundii [TaxId:546] [53001] (1 PDB entry)
  8. 2121283Domain d1cfra_: 1cfr A: [33312]

Details for d1cfra_

PDB Entry: 1cfr (more details), 2.15 Å

PDB Description: crystal structure of citrobacter freundii restriction endonuclease cfr10i at 2.15 angstroms resolution.
PDB Compounds: (A:) restriction endonuclease

SCOPe Domain Sequences for d1cfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfra_ c.52.1.7 (A:) Restriction endonuclease Cfr10I {Citrobacter freundii [TaxId: 546]}
mdiisksgegnkytinsaiafvayashidinttefskvlsglrdfindeairlggkisdg
sfnkcngdwyewligiraiefflesetnfivvkmpnatsfdvmsiyksclsefiydlrsk
lslnnvnlitsnpdfsiidirgrreelksmlkdisfsnislstiseidnlyknfidyael
ehiksflsvkttfrpdrrlqlahegslmkalythlqtrtwtinptgiryyaaatsignad
viglktvathsitdvkslpqsavdeifkinsvldvdsclshil

SCOPe Domain Coordinates for d1cfra_:

Click to download the PDB-style file with coordinates for d1cfra_.
(The format of our PDB-style files is described here.)

Timeline for d1cfra_: