Lineage for d5x31b1 (5x31 B:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2771001Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries)
  8. 2771007Domain d5x31b1: 5x31 B:1-123 [333112]
    Other proteins in same PDB: d5x31a2, d5x31b2
    automated match to d8paza_
    complexed with cu

Details for d5x31b1

PDB Entry: 5x31 (more details), 2.6 Å

PDB Description: pseudoazurin from alcaligenes faecalis (space group p65)
PDB Compounds: (B:) pseudoazurin

SCOPe Domain Sequences for d5x31b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x31b1 b.6.1.1 (B:1-123) automated matches {Alcaligenes faecalis [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

SCOPe Domain Coordinates for d5x31b1:

Click to download the PDB-style file with coordinates for d5x31b1.
(The format of our PDB-style files is described here.)

Timeline for d5x31b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x31b2