SCOPe 2.04: Domain d1pvib_: 1pvi B:

Lineage for d1pvib_ (1pvi B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
   automatically mapped to Pfam PF09225

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1pvib_: 1pvi B: [33311]
   protein/DNA complex

Details for d1pvib_

PDB Entry: 1pvi, 2.6 Å

PDB Description: structure of pvuii endonuclease with cognate dna

PDB Compounds: (B:) protein (pvuii (e.c.3.1.21.4))

SCOPe Domain Sequences for d1pvib_:

Sequence; same for both SEQRES and ATOM records:

>d1pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1pvib_:

• d1pvib_ first appeared (with stable ids) in SCOP 1.55
  
• d1pvib_ appears in SCOPe 2.03
  
• d1pvib_ appears in SCOPe 2.05
  
• d1pvib_ appears in the current release, SCOPe 2.08