SCOP 1.59: Domain d1pvib_: 1pvi B:

Lineage for d1pvib_ (1pvi B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)

8. Domain d1pvib_: 1pvi B: [33311]

Details for d1pvib_

PDB Entry: 1pvi, 2.8 Å

PDB Description: structure of pvuii endonuclease with cognate dna

SCOP Domain Sequences for d1pvib_:

Sequence; same for both SEQRES and ATOM records:

>d1pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1pvib_:

• d1pvib_ first appeared (with stable ids) in SCOP 1.55
  
• d1pvib_ appears in SCOP 1.57
  
• d1pvib_ appears in SCOP 1.61
  
• d1pvib_ appears in the current release, SCOPe 2.08