Lineage for d1pvib_ (1pvi B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71615Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 71616Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 71617Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)
  8. 71629Domain d1pvib_: 1pvi B: [33311]

Details for d1pvib_

PDB Entry: 1pvi (more details), 2.8 Å

PDB Description: structure of pvuii endonuclease with cognate dna

SCOP Domain Sequences for d1pvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d1pvib_:

Click to download the PDB-style file with coordinates for d1pvib_.
(The format of our PDB-style files is described here.)

Timeline for d1pvib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pvia_