SCOPe 2.08: Domain d5j5na1: 5j5n A:3-84

Lineage for d5j5na1 (5j5n A:3-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries)

8. Domain d5j5na1: 5j5n A:3-84 [333107]
   Other proteins in same PDB: d5j5na2, d5j5nb2
   automated match to d5agya1
   complexed with gsh; mutant

Details for d5j5na1

PDB Entry: 5j5n, 2.63 Å

PDB Description: crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione

PDB Compounds: (A:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j5na1:

Sequence; same for both SEQRES and ATOM records:

>d5j5na1 c.47.1.0 (A:3-84) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
sdqvtlldfwpspfgmrvrlalaekgvkyeyseedlwnksalllqmnpvnkqipvlvhng
kpvcesliivqyidevwkdsap

Timeline for d5j5na1:

• d5j5na1 first appeared in SCOPe 2.06
  
• d5j5na1 appears in SCOPe 2.07