Lineage for d5xa2a_ (5xa2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907986Species Planctopirus limnophila [TaxId:521674] [333102] (1 PDB entry)
  8. 2907987Domain d5xa2a_: 5xa2 A: [333103]
    automated match to d4lmab_

Details for d5xa2a_

PDB Entry: 5xa2 (more details), 2.03 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase from planctomyces limnophila
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d5xa2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xa2a_ c.79.1.0 (A:) automated matches {Planctopirus limnophila [TaxId: 521674]}
mpifkdnsesigrtplvqinrltaglssrvlakiegrnpaysvkcrigaamiwdaeqsgk
lkpgmhvveptsgntgialafvcaargykltltmpetmsierrmmlksfgadlvltpgad
gmkgaiskaeelaaqpgwfipqqfknpanpaihvkttgpeiwndtegqvdvfvagvgtgg
titgvarflkhekkhpvhvvavepaaspvlaggpagrhkiqgigagfvpdtfdrsvvdei
lsvtddeaietarklameegiscgiscgaamagalkvaarpefagktivtvlpdageryl
stalfenlr

SCOPe Domain Coordinates for d5xa2a_:

Click to download the PDB-style file with coordinates for d5xa2a_.
(The format of our PDB-style files is described here.)

Timeline for d5xa2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xa2b_