Class a: All alpha proteins [46456] (290 folds) |
Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
Protein automated matches [190930] (4 species) not a true protein |
Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries) |
Domain d5v7sc_: 5v7s C: [333101] automated match to d1aa7a_ complexed with po4 |
PDB Entry: 5v7s (more details), 2.5 Å
SCOPe Domain Sequences for d5v7sc_:
Sequence, based on SEQRES records: (download)
>d5v7sc_ a.95.1.1 (C:) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]} slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg fvftltvpserglqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysa galascmgliynrmgavttevafglvcatceqiadsqhrs
>d5v7sc_ a.95.1.1 (C:) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]} slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg fvftltvpsrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysagalas cmgliynrmgavttevafglvcatceqiadsqhrs
Timeline for d5v7sc_: