Lineage for d5v7sc_ (5v7s C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720943Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
    multihelical; consists of two different all-alpha subdomains, 4 helices each
  4. 2720944Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
    superficially similar to membrane translocation domains
    automatically mapped to Pfam PF00598
  5. 2720945Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)
  6. 2720952Protein automated matches [190930] (4 species)
    not a true protein
  7. 2720956Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries)
  8. 2720967Domain d5v7sc_: 5v7s C: [333101]
    automated match to d1aa7a_
    complexed with po4

Details for d5v7sc_

PDB Entry: 5v7s (more details), 2.5 Å

PDB Description: crystal structure of influenza a virus matrix protein m1 (nls-88e, ph 6.2)
PDB Compounds: (C:) matrix protein 1

SCOPe Domain Sequences for d5v7sc_:

Sequence, based on SEQRES records: (download)

>d5v7sc_ a.95.1.1 (C:) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysa
galascmgliynrmgavttevafglvcatceqiadsqhrs

Sequence, based on observed residues (ATOM records): (download)

>d5v7sc_ a.95.1.1 (C:) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpsrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysagalas
cmgliynrmgavttevafglvcatceqiadsqhrs

SCOPe Domain Coordinates for d5v7sc_:

Click to download the PDB-style file with coordinates for d5v7sc_.
(The format of our PDB-style files is described here.)

Timeline for d5v7sc_: