![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
![]() | Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) ![]() superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
![]() | Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
![]() | Protein automated matches [190930] (4 species) not a true protein |
![]() | Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries) |
![]() | Domain d5v7sa_: 5v7s A: [333096] automated match to d1aa7a_ complexed with po4 |
PDB Entry: 5v7s (more details), 2.5 Å
SCOPe Domain Sequences for d5v7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v7sa_ a.95.1.1 (A:) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]} slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg fvftltvpserglqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysa galascmgliynrmgavttevafglvcatceqiadsqhrshrqm
Timeline for d5v7sa_: