SCOPe 2.06: Domain d5v7rl1: 5v7r L:1-106

Lineage for d5v7rl1 (5v7r L:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d5v7rl1: 5v7r L:1-106 [333090]
   Other proteins in same PDB: d5v7rl2
   automated match to d1dn0a1

Details for d5v7rl1

PDB Entry: 5v7r, 2.3 Å

PDB Description: cyrstal structure of anti-tau antibody cbtau-7.1 fab

PDB Compounds: (L:) CBTAU-7.1 Fab light chain

SCOPe Domain Sequences for d5v7rl1:

Sequence; same for both SEQRES and ATOM records:

>d5v7rl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdtlslspgeratlscrasqiissnylawyqqqpgqaprlliygassratgip
drfsgsgsatdftltisrlepedfavyycqqygtsprtfgqgtklei

Timeline for d5v7rl1:

• d5v7rl1 is new in SCOPe 2.06-stable
  
• d5v7rl1 appears in SCOPe 2.07
  
• d5v7rl1 appears in the current release, SCOPe 2.08