Lineage for d5v3tb_ (5v3t B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685940Protein automated matches [190322] (4 species)
    not a true protein
  7. 2685941Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [333034] (3 PDB entries)
  8. 2685943Domain d5v3tb_: 5v3t B: [333080]
    automated match to d2bkma_
    complexed with cyn, hem, so4

Details for d5v3tb_

PDB Entry: 5v3t (more details), 1.9 Å

PDB Description: crystal structure of the group ii truncated hemoglobin from bacillus anthracis
PDB Compounds: (B:) globin

SCOPe Domain Sequences for d5v3tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v3tb_ a.1.1.1 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylggpnly
teehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhmvn
tpn

SCOPe Domain Coordinates for d5v3tb_:

Click to download the PDB-style file with coordinates for d5v3tb_.
(The format of our PDB-style files is described here.)

Timeline for d5v3tb_: