| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
| Protein automated matches [190322] (4 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [333034] (3 PDB entries) |
| Domain d5v3tb_: 5v3t B: [333080] automated match to d2bkma_ complexed with cyn, hem, so4 |
PDB Entry: 5v3t (more details), 1.9 Å
SCOPe Domain Sequences for d5v3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v3tb_ a.1.1.1 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylggpnly
teehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhmvn
tpn
Timeline for d5v3tb_: