![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
![]() | Protein automated matches [190559] (3 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:1316921] [332994] (2 PDB entries) |
![]() | Domain d5tcyc1: 5tcy C:24-310 [333073] Other proteins in same PDB: d5tcya2, d5tcyb2, d5tcyc2 automated match to d3zkwa_ complexed with 5lc, fe |
PDB Entry: 5tcy (more details), 1.9 Å
SCOPe Domain Sequences for d5tcyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tcyc1 c.92.2.4 (C:24-310) automated matches {Campylobacter jejuni [TaxId: 1316921]} lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq srfgiihdvlginavdenikvgtlgksinsefileknpdyifvvdrnvilgnkeraqgil dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
Timeline for d5tcyc1:
![]() Domains from other chains: (mouse over for more information) d5tcya1, d5tcya2, d5tcyb1, d5tcyb2 |