SCOP 1.61: Domain d1pvub_: 1pvu B:

Lineage for d1pvub_ (1pvu B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)

8. Domain d1pvub_: 1pvu B: [33307]

Details for d1pvub_

PDB Entry: 1pvu, 2.4 Å

PDB Description: the crystal structure of pvuii endonuclease reveals extensive structural homologies to ecorv

SCOP Domain Sequences for d1pvub_:

Sequence; same for both SEQRES and ATOM records:

>d1pvub_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
ydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1pvub_:

• d1pvub_ first appeared (with stable ids) in SCOP 1.55
  
• d1pvub_ appears in SCOP 1.59
  
• d1pvub_ appears in SCOP 1.63
  
• d1pvub_ appears in the current release, SCOPe 2.08