![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Methionine gamma-lyase, MGL [64126] (4 species) |
![]() | Species Pseudomonas putida [TaxId:303] [75271] (15 PDB entries) Uniprot P13254 |
![]() | Domain d5x2zc_: 5x2z C: [333069] automated match to d1ukja_ complexed with 3lm; mutant |
PDB Entry: 5x2z (more details), 1.8 Å
SCOPe Domain Sequences for d5x2zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x2zc_ c.67.1.3 (C:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah ygiseglvrlsvglediddlladvqqalkasa
Timeline for d5x2zc_: