SCOPe 2.08: Domain d5v7bb1: 5v7b B:2-161

Lineage for d5v7bb1 (5v7b B:2-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries)

8. Domain d5v7bb1: 5v7b B:2-161 [333066]
   Other proteins in same PDB: d5v7ba2, d5v7bb2
   automated match to d1aa7a_

Details for d5v7bb1

PDB Entry: 5v7b, 2.5 Å

PDB Description: crystal structure of influenza a virus matrix protein m1 (nls-88e)

PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d5v7bb1:

Sequence, based on SEQRES records:

>d5v7bb1 a.95.1.1 (B:2-161) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysa
galascmgliynrmgavttevafglvcatceqiadsqhrs

Sequence, based on observed residues (ATOM records):

>d5v7bb1 a.95.1.1 (B:2-161) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysagalas
cmgliynrmgavttevafglvcatceqiadsqhrs

Timeline for d5v7bb1:

• d5v7bb1 first appeared in SCOPe 2.06
  
• d5v7bb1 appears in SCOPe 2.07