Lineage for d5v7bb1 (5v7b B:2-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720943Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
    multihelical; consists of two different all-alpha subdomains, 4 helices each
  4. 2720944Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
    superficially similar to membrane translocation domains
    automatically mapped to Pfam PF00598
  5. 2720945Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)
  6. 2720952Protein automated matches [190930] (4 species)
    not a true protein
  7. 2720956Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries)
  8. 2720964Domain d5v7bb1: 5v7b B:2-161 [333066]
    Other proteins in same PDB: d5v7ba2, d5v7bb2
    automated match to d1aa7a_

Details for d5v7bb1

PDB Entry: 5v7b (more details), 2.5 Å

PDB Description: crystal structure of influenza a virus matrix protein m1 (nls-88e)
PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d5v7bb1:

Sequence, based on SEQRES records: (download)

>d5v7bb1 a.95.1.1 (B:2-161) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysa
galascmgliynrmgavttevafglvcatceqiadsqhrs

Sequence, based on observed residues (ATOM records): (download)

>d5v7bb1 a.95.1.1 (B:2-161) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpqrrrfvqnalngnedpnnmdkavklysklkseitfhgakeialsysagalas
cmgliynrmgavttevafglvcatceqiadsqhrs

SCOPe Domain Coordinates for d5v7bb1:

Click to download the PDB-style file with coordinates for d5v7bb1.
(The format of our PDB-style files is described here.)

Timeline for d5v7bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v7bb2