SCOP 1.69: Domain d1pvua_: 1pvu A:

Lineage for d1pvua_ (1pvu A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1pvua_: 1pvu A: [33306]

Details for d1pvua_

PDB Entry: 1pvu, 2.4 Å

PDB Description: the crystal structure of pvuii endonuclease reveals extensive structural homologies to ecorv

SCOP Domain Sequences for d1pvua_:

Sequence; same for both SEQRES and ATOM records:

>d1pvua_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
ydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1pvua_:

• d1pvua_ first appeared (with stable ids) in SCOP 1.55
  
• d1pvua_ appears in SCOP 1.67
  
• d1pvua_ appears in SCOP 1.71
  
• d1pvua_ appears in the current release, SCOPe 2.08