Class a: All alpha proteins [46456] (289 folds) |
Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
Protein automated matches [190930] (5 species) not a true protein |
Species Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [333036] (4 PDB entries) |
Domain d5v6ga_: 5v6g A: [333052] automated match to d1aa7a_ |
PDB Entry: 5v6g (more details), 2 Å
SCOPe Domain Sequences for d5v6ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v6ga_ a.95.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]} slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg fvftltvpserglqrrrfvqnalngnrdpnnmdkavklysklkseitfhgakeialsysa galascmgliynrmgavttevafglvcatceqiadsq
Timeline for d5v6ga_: