SCOPe 2.06: Domain d5v6ga_: 5v6g A:

Lineage for d5v6ga_ (5v6g A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (5 species)
   not a true protein

7. Species Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [333036] (4 PDB entries)

8. Domain d5v6ga_: 5v6g A: [333052]
   automated match to d1aa7a_

Details for d5v6ga_

PDB Entry: 5v6g, 2 Å

PDB Description: crystal structure of influenza a virus matrix protein m1(nls-88r)

PDB Compounds: (A:) matrix protein 1

SCOPe Domain Sequences for d5v6ga_:

Sequence; same for both SEQRES and ATOM records:

>d5v6ga_ a.95.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngnrdpnnmdkavklysklkseitfhgakeialsysa
galascmgliynrmgavttevafglvcatceqiadsq

Timeline for d5v6ga_:

• d5v6ga_ is new in SCOPe 2.06-stable
  
• d5v6ga_ appears in SCOPe 2.07
  
• d5v6ga_ appears in the current release, SCOPe 2.08