Lineage for d5ukma2 (5ukm A:186-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543768Protein G-protein coupled receptor kinase 2 [90034] (1 species)
    AGC group; GRKs subfamily; serine/threonine kinase
  7. 2543769Species Cow (Bos taurus) [TaxId:9913] [90035] (10 PDB entries)
  8. 2543777Domain d5ukma2: 5ukm A:186-549 [333046]
    Other proteins in same PDB: d5ukma1, d5ukma3, d5ukmb_, d5ukmg_
    automated match to d3v5wa2
    complexed with cmt, mg, t0e

Details for d5ukma2

PDB Entry: 5ukm (more details), 3.03 Å

PDB Description: bovine grk2 in complex with human gbetagamma subunits and ccg258208 (14as)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukma2:

Sequence, based on SEQRES records: (download)

>d5ukma2 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d5ukma2 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
klldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh

SCOPe Domain Coordinates for d5ukma2:

Click to download the PDB-style file with coordinates for d5ukma2.
(The format of our PDB-style files is described here.)

Timeline for d5ukma2: