Lineage for d5v9ga2 (5v9g A:260-622)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519433Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2519434Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2519435Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 proteins)
  6. 2519436Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69612] (2 species)
  7. 2519446Species Norway rat (Rattus norvegicus) [TaxId:10116] [225316] (42 PDB entries)
  8. 2519487Domain d5v9ga2: 5v9g A:260-622 [333042]
    Other proteins in same PDB: d5v9ga1
    automated match to d3dtba2
    complexed with gtp, mn, na, oxl

Details for d5v9ga2

PDB Entry: 5v9g (more details), 1.95 Å

PDB Description: structure of the h477r variant of rat cytosolic pepck in complex with oxalate and gtp.
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d5v9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v9ga2 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkvimrdpfamrpffgynfgkylahwls
mahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvp
kedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqri
sqm

SCOPe Domain Coordinates for d5v9ga2:

Click to download the PDB-style file with coordinates for d5v9ga2.
(The format of our PDB-style files is described here.)

Timeline for d5v9ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v9ga1