SCOPe 2.08: Domain d5lwqc1: 5lwq C:24-310

Lineage for d5lwqc1 (5lwq C:24-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein automated matches [190559] (3 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:1316921] [332994] (2 PDB entries)

8. Domain d5lwqc1: 5lwq C:24-310 [333030]
   Other proteins in same PDB: d5lwqa2, d5lwqb2, d5lwqc2
   automated match to d3zkwa_
   complexed with br, na

Details for d5lwqc1

PDB Entry: 5lwq, 1.52 Å

PDB Description: ceue (h227l variant) a periplasmic protein from campylobacter jejuni

PDB Compounds: (C:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d5lwqc1:

Sequence; same for both SEQRES and ATOM records:

>d5lwqc1 c.92.2.4 (C:24-310) automated matches {Campylobacter jejuni [TaxId: 1316921]}
lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgtlgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

Timeline for d5lwqc1:

• d5lwqc1 first appeared in SCOPe 2.06
  
• d5lwqc1 appears in SCOPe 2.07