Lineage for d2pvib_ (2pvi B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24860Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 24861Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 24862Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)
  8. 24866Domain d2pvib_: 2pvi B: [33303]

Details for d2pvib_

PDB Entry: 2pvi (more details), 1.76 Å

PDB Description: pvuii endonuclease complexed to an iodinated cognate dna

SCOP Domain Sequences for d2pvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d2pvib_:

Click to download the PDB-style file with coordinates for d2pvib_.
(The format of our PDB-style files is described here.)

Timeline for d2pvib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pvia_