Lineage for d2pvib_ (2pvi B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein) Protein Restriction endonuclease PvuII [52997] (1 species) Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries) 
Domain d2pvib_: 2pvi B: [33303]
Details for d2pvib_
PDB Entry: 2pvi (more details), 1.76 Å
PDB Description: pvuii endonuclease complexed to an iodinated cognate dna
SCOP Domain Sequences for d2pvib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
SCOP Domain Coordinates for d2pvib_:
Click to download the PDB-style file with coordinates for d2pvib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pvib_:
- d2pvib_ appears in SCOP 1.57
- d2pvib_ appears in the current release, SCOPe 2.08
View in 3D
