Lineage for d5tyha_ (5tyh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403492Family b.81.1.8: PglD-like [159280] (2 protein domains)
    contains extra N-terminal alpha/beta subdomain
  6. 2403504Protein automated matches [330112] (1 species)
    not a true protein
  7. 2403505Species Campylobacter jejuni [TaxId:192222] [330113] (2 PDB entries)
  8. 2403508Domain d5tyha_: 5tyh A: [333028]
    automated match to d3bfpa_
    complexed with 7o4

Details for d5tyha_

PDB Entry: 5tyh (more details), 2.1 Å

PDB Description: pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid
PDB Compounds: (A:) UDP-N-acetylbacillosamine N-acetyltransferase

SCOPe Domain Sequences for d5tyha_:

Sequence, based on SEQRES records: (download)

>d5tyha_ b.81.1.8 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records): (download)

>d5tyha_ b.81.1.8 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiyghglvcedvaknmgykecifldfestlpkydffiaignneirkkiyqkise
ngfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvig
efshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdekgvfvgv
pakrm

SCOPe Domain Coordinates for d5tyha_:

Click to download the PDB-style file with coordinates for d5tyha_.
(The format of our PDB-style files is described here.)

Timeline for d5tyha_: