Lineage for d5tg8a_ (5tg8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776372Species Influenza A virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId:650409] [333007] (2 PDB entries)
  8. 2776375Domain d5tg8a_: 5tg8 A: [333021]
    Other proteins in same PDB: d5tg8b_, d5tg8d_
    automated match to d4xkga_
    complexed with nag

Details for d5tg8a_

PDB Entry: 5tg8 (more details), 3.1 Å

PDB Description: crystal structure of h15 hemagglutinin from a/shearwater/wa/2576/1979 h15n9 influenza virus
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5tg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tg8a_ b.19.1.0 (A:) automated matches {Influenza A virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId: 650409]}
dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti
igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi
rtdgatsackrtvssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld
eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng
afiapdratflrsnapsgieyngkslgiqsdaqidescegecfysggtinsplpfqnids
ravgkcpryvkqsslplalgmknvpeki

SCOPe Domain Coordinates for d5tg8a_:

Click to download the PDB-style file with coordinates for d5tg8a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg8a_: