| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) ![]() |
| Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein) |
| Protein Restriction endonuclease PvuII [52997] (1 species) |
| Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries) |
| Domain d2pvia_: 2pvi A: [33302] |
PDB Entry: 2pvi (more details), 1.76 Å
SCOP Domain Sequences for d2pvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
Timeline for d2pvia_: