SCOP 1.65: Domain d2pvia_: 2pvi A:

Lineage for d2pvia_ (2pvi A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (8 PDB entries)

8. Domain d2pvia_: 2pvi A: [33302]

Details for d2pvia_

PDB Entry: 2pvi, 1.76 Å

PDB Description: pvuii endonuclease complexed to an iodinated cognate dna

SCOP Domain Sequences for d2pvia_:

Sequence; same for both SEQRES and ATOM records:

>d2pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d2pvia_:

• d2pvia_ first appeared (with stable ids) in SCOP 1.55
  
• d2pvia_ appears in SCOP 1.63
  
• d2pvia_ appears in SCOP 1.67
  
• d2pvia_ appears in the current release, SCOPe 2.08