Lineage for d2pvia_ (2pvi A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71615Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 71616Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 71617Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)
  8. 71620Domain d2pvia_: 2pvi A: [33302]

Details for d2pvia_

PDB Entry: 2pvi (more details), 1.76 Å

PDB Description: pvuii endonuclease complexed to an iodinated cognate dna

SCOP Domain Sequences for d2pvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d2pvia_:

Click to download the PDB-style file with coordinates for d2pvia_.
(The format of our PDB-style files is described here.)

Timeline for d2pvia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pvib_