Lineage for d5twfb_ (5twf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2322039Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2322040Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2322046Protein automated matches [319235] (2 species)
    not a true protein
  7. 2322047Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)
  8. 2322058Domain d5twfb_: 5twf B: [333012]
    automated match to d1pi1a_
    complexed with zn

Details for d5twfb_

PDB Entry: 5twf (more details), 3.14 Å

PDB Description: regulation of protein interactions by mob1 phosphorylation
PDB Compounds: (B:) MOB kinase activator 1A

SCOPe Domain Sequences for d5twfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5twfb_ a.29.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcte
ascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfp
knfmsvaktilkrlfrvyahiyhqhfdsvmqleeeahlntsfkhfiffvqefnlidrrel
aplqeliekl

SCOPe Domain Coordinates for d5twfb_:

Click to download the PDB-style file with coordinates for d5twfb_.
(The format of our PDB-style files is described here.)

Timeline for d5twfb_: