![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.7: Mob1/phocein [101152] (1 family) ![]() common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
![]() | Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
![]() | Protein automated matches [319235] (2 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [333010] (1 PDB entry) |
![]() | Domain d5twfb_: 5twf B: [333012] automated match to d1pi1a_ complexed with zn |
PDB Entry: 5twf (more details), 3.14 Å
SCOPe Domain Sequences for d5twfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5twfb_ a.29.7.1 (B:) automated matches {Homo sapiens [TaxId: 9606]} gshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcte ascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfp knfmsvaktilkrlfrvyahiyhqhfdsvmqleeeahlntsfkhfiffvqefnlidrrel aplqeliekl
Timeline for d5twfb_: