SCOPe 2.06: Domain d5twfa_: 5twf A:

Lineage for d5twfa_ (5twf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.7: Mob1/phocein [101152] (1 family)
   common fold is elaborated with additional short helices; contains a zinc-binding site
   automatically mapped to Pfam PF03637

5. Family a.29.7.1: Mob1/phocein [101153] (2 proteins)

6. Protein automated matches [319235] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [333010] (1 PDB entry)

8. Domain d5twfa_: 5twf A: [333011]
   automated match to d1pi1a_
   complexed with zn

Details for d5twfa_

PDB Entry: 5twf, 3.14 Å

PDB Description: regulation of protein interactions by mob1 phosphorylation

PDB Compounds: (A:) MOB kinase activator 1A

SCOPe Domain Sequences for d5twfa_:

Sequence, based on SEQRES records:

>d5twfa_ a.29.7.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
pegshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefc
teascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvp
fpknfmsvaktilkrlfrvyahiyhqhfdsvmqleeeahlntsfkhfiffvqefnlidrr
elaplqeliekl

Sequence, based on observed residues (ATOM records):

>d5twfa_ a.29.7.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
pegshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefc
teascpvmsayeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpk
nfmsvaktilkrlfrvyahiyhqhfdsvmqleeeahlntsfkhfiffvqefnlidrrela
plqeliekl

Timeline for d5twfa_:

• d5twfa_ is new in SCOPe 2.06-stable
  
• d5twfa_ appears in SCOPe 2.07
  
• d5twfa_ appears in the current release, SCOPe 2.08