Lineage for d5tg9a_ (5tg9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048224Species Influenza a virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId:650409] [333007] (2 PDB entries)
  8. 2048225Domain d5tg9a_: 5tg9 A: [333008]
    Other proteins in same PDB: d5tg9b_, d5tg9d_
    automated match to d4xkga_
    complexed with gal, nag, sia

Details for d5tg9a_

PDB Entry: 5tg9 (more details), 2.75 Å

PDB Description: crystal structure of h15 hemagglutinin from a/shearwater/wa/2576/1979 h15n9 influenza virus in complex with 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5tg9a_:

Sequence, based on SEQRES records: (download)

>d5tg9a_ b.19.1.0 (A:) automated matches {Influenza a virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId: 650409]}
dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti
igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi
rtdgatsackrtvssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld
eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng
afiapdratflrsnapsgieyngkslgiqsdaqidescegecfysggtinsplpfqnids
ravgkcpryvkqsslplalgmknvpeki

Sequence, based on observed residues (ATOM records): (download)

>d5tg9a_ b.19.1.0 (A:) automated matches {Influenza a virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId: 650409]}
dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti
igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi
rtdgatsackrtvssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld
eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng
afiapdratflrsnaieyngkslgiqsdaqidescegecfysggtinsplpfqnidsrav
gkcpryvkqsslplalgmknvpeki

SCOPe Domain Coordinates for d5tg9a_:

Click to download the PDB-style file with coordinates for d5tg9a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg9a_: